PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009595050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 277aa    MW: 31385.4 Da    PI: 6.5034
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009595050.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l++     G  +W+++++  g++R++k+c++rw +yl
   XP_009595050.1 14 KGPWTTEEDKKLINFLLTNGQCCWRSVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding40.85.2e-1367111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E++l +d++  lG++ W++Ia +++ gRt++++k+ w+++
   XP_009595050.1  67 RGVLTEVEEKLVIDLHSCLGNR-WSKIAVRLP-GRTDNEIKNNWNTH 111
                      6788******************.*********.***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-20563IPR009057Homeodomain-like
PROSITE profilePS5129413.921961IPR017930Myb domain
SuperFamilySSF466892.62E-2511108IPR009057Homeodomain-like
SMARTSM007174.4E-121363IPR001005SANT/Myb domain
PfamPF002491.5E-141461IPR001005SANT/Myb domain
CDDcd001671.22E-81661No hitNo description
PROSITE profilePS5129420.94362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2164116IPR009057Homeodomain-like
SMARTSM007172.9E-1066114IPR001005SANT/Myb domain
PfamPF002493.2E-1167111IPR001005SANT/Myb domain
CDDcd001673.52E-871112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTTE EDKKLINFLL TNGQCCWRSV PKLAGLRRCG KSCRLRWTNY  60
LHPDLKRGVL TEVEEKLVID LHSCLGNRWS KIAVRLPGRT DNEIKNNWNT HIKKKLLKMG  120
IDPITHEPLH KETKPSNQST TTGHQQVHVV PESTNVIAQS TNVVAESTNV TKASTSLELE  180
NSSIFSYDLS FSPNENSSCI TDETQLVLDT FTDVAHLIDS PWEFSASATA QKQNFDNENF  240
NWLLDCQDFG IQDFGFDNFN VEKDFILNTI DDIGNKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009595050.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-114ODO1_PETHY; Protein ODORANT1
TrEMBLF5CSR81e-112F5CSR8_9SOLA; MYB transcription factor ODO1
TrEMBLF5CSR91e-112F5CSR9_9SOLA; MYB transcription factor ODO1
STRINGSolyc08g079270.2.11e-111(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.13e-90myb domain protein 85